Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MVENPMVINNWHDKLTETDVQIDFYGDEVTPVDDYVIDGG-EIILRENLERYLR--EQLGFEFKNAQ 2H3H Chain:A ((274-304)) ---------------------------------DYVIDTGVDVVTPENLDEYLKKMEELGIPIK---

General information: TITO was launched using: RESULT: Template: 2H3H.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 24 -1646 -68.56 -58.77 target 2D structure prediction score : 0.36 Monomeric hydrophicity matching model chain A : 0.70 3D Compatibility (PKB) : -68.56 2D Compatibility (Sec. Struct. Predict.) : 0.36 1D Compatibility (Hydrophobicity) : 0.70 QMean score : 0.616

(partial model without unconserved sides chains): PDB file : Tito_2H3H.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2H3H-query.scw PDB file : Tito_Scwrl_2H3H.pdb: