Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MVYFVAFFCFAITLHNIEEAIWLPEWSQQSSKFQKPVTSNEFHFAVIVITMLAYLSAFGFLYMPESDIAKWIFIGFLGSMVINAIFPHLIATVVMKKYAPGLLTGLLLNIPVNSLVIYQMFLKNLIVWKELIISTLVVGIILLALIPLLFKVGDKVSP 4A4M Chain:A ((221-277)) ----VIFFCYGQLVFTVKEAAAQQQESATTQKAEKEVTR----------MVIIYVIAFLICWLPYAGVAFYIF-------------------------------------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 4A4M.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 78 2794 35.81 49.01 target 2D structure prediction score : 0.65 Monomeric hydrophicity matching model chain A : 0.46 3D Compatibility (PKB) : 35.81 2D Compatibility (Sec. Struct. Predict.) : 0.65 1D Compatibility (Hydrophobicity) : 0.46 QMean score : -0.308

(partial model without unconserved sides chains): PDB file : Tito_4A4M.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4A4M-query.scw PDB file : Tito_Scwrl_4A4M.pdb: