Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MHIKIDDLTGRQVVSLVNEHLHSMTLMSPPESIHALGLEKLRGPEITFWSAWEGDELAGCGALKELDTRHGEIKSMRTSASHLRKGVAKQVLQHIIEEAEKRGYERLSLETGSMASFEPARKLYESFGFQYCEPFADYGEDPNSVFMTKKL 4MBU Chain:A ((86-148)) --------------------------------------------------------------------------SIYVDASARGKGIASQLLQRLIVEAKAKGYR--TLVAGIDASNEASIKLHQKFNFKHAGTLTNVG------------

General information: TITO was launched using: RESULT: Template: 4MBU.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 129 -21402 -165.90 -339.71 target 2D structure prediction score : 0.60 Monomeric hydrophicity matching model chain A : 0.63 3D Compatibility (PKB) : -165.90 2D Compatibility (Sec. Struct. Predict.) : 0.60 1D Compatibility (Hydrophobicity) : 0.63 QMean score : 0.751

(partial model without unconserved sides chains): PDB file : Tito_4MBU.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4MBU-query.scw PDB file : Tito_Scwrl_4MBU.pdb: