Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MNRNQAIIASLCYFSVFIAPIIVPIVAYFVVNEKETKRHAIRSLISHIVPFVGWLFLFIALLGGAVAIDGDSLLPVFVIIGGAVIYFL---VVIGIIIWNVIQGIKVLRAA 3GD4 Chain:A ((459-487)) --------------------------------------------------------------------------------GKGVIFYLRDKVVVGIVLWNVFNRMPIAR--

General information: TITO was launched using: RESULT: Template: 3GD4.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 42 -13719 -326.64 -527.65 target 2D structure prediction score : 0.04 Monomeric hydrophicity matching model chain A : 0.49 3D Compatibility (PKB) : -326.64 2D Compatibility (Sec. Struct. Predict.) : 0.04 1D Compatibility (Hydrophobicity) : 0.49 QMean score : 0.859

(partial model without unconserved sides chains): PDB file : Tito_3GD4.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3GD4-query.scw PDB file : Tito_Scwrl_3GD4.pdb: