Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MEKDPSDYTVTQESVLKLIQEQKRMNREMITELEQIHGPFPISHDIQYIKVLLDSSNTHIVQDLMSVSKQLYKKTL 2G76 Chain:A ((36-90)) ---DPCCRKILQDGGLQVVEKQNLSKEELIAELQDCEG-------------LIVRSATKVTADVINAAEKL-----

General information: TITO was launched using: RESULT: Template: 2G76.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 129 -13691 -106.13 -248.93 target 2D structure prediction score : 0.42 Monomeric hydrophicity matching model chain A : 0.74 3D Compatibility (PKB) : -106.13 2D Compatibility (Sec. Struct. Predict.) : 0.42 1D Compatibility (Hydrophobicity) : 0.74 QMean score : 0.289

(partial model without unconserved sides chains): PDB file : Tito_2G76.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2G76-query.scw PDB file : Tito_Scwrl_2G76.pdb: