Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MSEIKLKYDTVIKTLDSVKDALADVSIGAAGSNGKNSLDYTKKYHEREENIKTMLGDYKKAVQKNIEDTKDNVDSLKEQDEAIAVK 2DTJ Chain:A ((37-81)) LADAEINIDMVLQNVSSVEDGTTDITFTCPRSDGRRAMEILKKLQ-----------------------------------------

General information: TITO was launched using: RESULT: Template: 2DTJ.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 85 -7121 -83.77 -158.23 target 2D structure prediction score : 0.29 Monomeric hydrophicity matching model chain A : 0.80 3D Compatibility (PKB) : -83.77 2D Compatibility (Sec. Struct. Predict.) : 0.29 1D Compatibility (Hydrophobicity) : 0.80 QMean score : 0.249

(partial model without unconserved sides chains): PDB file : Tito_2DTJ.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2DTJ-query.scw PDB file : Tito_Scwrl_2DTJ.pdb: