Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence M-----------------HTCPRCDSK-------KGEVMSKSPVEGAWEVYQCQTC-FFTWRSCEPESIT-NPEKYNP---AFKID-PKETETAIEVPAVPERKA 2GHF Chain:A ((1-102)) MAHHHHHHNQQNKKVEGGYECKYCTFQTPDLNMFTFHVDSEHPNVVLNSSYVCVECNFLTKRY---DALSEHNLKYHPGEENFKLTMVKRNNQTIFEQTINDLTF

General information: TITO was launched using: RESULT: Template: 2GHF.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 283 -10239 -36.18 -142.20 target 2D structure prediction score : 0.60 Monomeric hydrophicity matching model chain A : 0.68 3D Compatibility (PKB) : -36.18 2D Compatibility (Sec. Struct. Predict.) : 0.60 1D Compatibility (Hydrophobicity) : 0.68 QMean score : 0.233

(partial model without unconserved sides chains): PDB file : Tito_2GHF.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2GHF-query.scw PDB file : Tito_Scwrl_2GHF.pdb: