Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence ---------------------------------------------------------------------------------------------------------------------MGTIVCQDCNEAIHYFEDEKVTTLYGTCCGQCQCPVDEE----- 1GXJ Chain:A ((498-658)) GFSRAVRAVFEEKERFPGLVDVVSNLIEVDEKYSLAVSVLLGGTAQNIVVRNVDTAKAIVEFLKQNEAGRVTILPLDLIDGSFNRISGLENERGFVGYAVDLVKFPSDLEVLGGFLFGNSVVVETLDDAIRMKKKYRLNTRIATLDGELISGRGAITGGRE

General information: TITO was launched using: RESULT: Template: 1GXJ.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 121 -14503 -119.86 -371.86 target 2D structure prediction score : 0.74 Monomeric hydrophicity matching model chain A : 0.52 3D Compatibility (PKB) : -119.86 2D Compatibility (Sec. Struct. Predict.) : 0.74 1D Compatibility (Hydrophobicity) : 0.52 QMean score : 0.624

(partial model without unconserved sides chains): PDB file : Tito_1GXJ.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1GXJ-query.scw PDB file : Tito_Scwrl_1GXJ.pdb: