Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence------------------------------------------------------------------------------------------------------------MERFIKRLSASCESTIHHKVYQIMNEAKTEFEKVLKKLK---------------
1IN0 Chain:A ((2-163))PSFDIVSEITLHEVRNAVENANRVLSTRYDFRGVEAVIELNEKNETIKITTESDFQLEQLIEILIGSCIKRGIEHSSLDIPAESEHHGKLYSKEIKLKQGIETEMAKKITKLVKDSKIKVQTQIQGEQVRVTGKSRDDLQAVIQLVKSAELGQPFQFNNFRD


General information:
TITO was launched using:
RESULT:

Template: 1IN0.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 26 1898 72.98 48.65
target 2D structure prediction score : 0.46
Monomeric hydrophicity matching model chain A : 0.62

3D Compatibility (PKB) : 72.98
2D Compatibility (Sec. Struct. Predict.) : 0.46
1D Compatibility (Hydrophobicity) : 0.62
QMean score : 0.358

(partial model without unconserved sides chains):
PDB file : Tito_1IN0.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1IN0-query.scw
PDB file : Tito_Scwrl_1IN0.pdb: