Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMNIVVLISGNGSNLQAIIDACKTNKIKGTVRAVFSNKADAFGLERARQAGIATHTLIASAFDSREAYDRELIHEIDMYAPDVVVLAGFMRILSPAFVSHYAGRLLNIHPSLLPKYPGLHTHRQALENGDEEHGTSVHFVTDELDGGPVILQAKVPVFAGDSEDDITARVQTQEHAIYPLVISWFADGRLKMHENAAWLDGQRLPPQGYAADE
1CDE Chain:C ((1-209))MNIVVLISGNGSNLQAIIDACKTNKIKGTVRAVFSNKADAFGLERARQAGIATHTLIASAFDSREAYDRELIHEIDMYAPDVVVLAGFMRILSPAFVSHYAGRLLNIHPSLLPKYPGLHTHRQALENGDEEHGTSVHFVTDELDGGPVILQAKVPVFAGDSEDDITARVQTQEHAIYPLVISWFADGRLKMHENAAWLDGQRLPPQGYA---


General information:
TITO was launched using:
RESULT:

Template: 1CDE.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -162813 for 1696 contacts (-96.0/contact) +
2D Compatibility (PS) -23513 + (NN) -13501 + (LL) 172
1D Compatibility (HY) -28000 + (ID) 10450
Total energy: -238105.0 ( -140.39 by residue)
QMean score : 0.862

(partial model without unconserved sides chains):
PDB file : Tito_1CDE.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1CDE-query.scw
PDB file : Tito_Scwrl_1CDE.pdb: