Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence------------------------------------------------------------------------------------------------KTLILGEEVKATCDFTKFQVCKPE-----IITGSPPSEECCEKLKEQQSCLCAYLISPSISQYI-------------GNAKRVIRACGIPFPNCS-------------------------------------------------------------
1IHU Chain:A ((308-586))QRPDIPSLSALVDDIARNEHGLIMLMGKGGVGKTTMAAAIAVRLADMGFDVHLTTSDPANNLQVSRIDPHEETERYRQHVLETKGKELDEAGKRLLEEDLRSPCTEEIAVFQAFSRVIREAGKRFVVMDTAPTGHTLLLLDATTP--MMLLQDPERTKVLLVTLPETTPVLEAANLQADLERAGIHPWGWIINNSLSIADTRSPLLRMRAQQELPQIESVKRQHASRVALVPVLASEPTGIDKLKQLAGHHH


General information:
TITO was launched using:
RESULT:

Template: 1IHU.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -7822 for 439 contacts (-17.8/contact) +
2D Compatibility (PS) -8095 + (NN) -5978 + (LL) 232
1D Compatibility (HY) -2000 + (ID) 500
Total energy: -24163.0 ( -55.04 by residue)
QMean score : 0.304

(partial model without unconserved sides chains):
PDB file : Tito_1IHU.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1IHU-query.scw
PDB file : Tito_Scwrl_1IHU.pdb: