Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence------------ATTCNALQLSPCAGAIIGNAAP-----TAACCSRMKAQQPCLCQYAKDPNLQ-----RYVSSPNGKKVMAACKVPVPSC------------------------------------------------------
1KNG Chain:A ((50-193))RPAPQTALPPLEGLQADNVQVPGLDPAAFKG-KVSLVNVWASWCVPCHDEAPLLTELGKDKRFQLVGINYKDAADNARRFLGRYGNPFGRVGVDANGRASIEWGVYGVPETFVVGREGTIVYKLVGPITPDNLRSVLLPQMEKAL


General information:
TITO was launched using:
RESULT:

Template: 1KNG.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -15948 for 366 contacts (-43.6/contact) +
2D Compatibility (PS) -6961 + (NN) 1176 + (LL) 144
1D Compatibility (HY) -4000 + (ID) 550
Total energy: -26139.0 ( -71.42 by residue)
QMean score : 0.238

(partial model without unconserved sides chains):
PDB file : Tito_1KNG.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1KNG-query.scw
PDB file : Tito_Scwrl_1KNG.pdb: