Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence--MNWKLTKTLFIFVFILVNIVLVS-----IYVNKVNR--SHINEVESNNEVNFQQEEIKVPASILNKSVK-----GIKLEQIT-GRSKDFSSKAKGDSDLTTSDGGKLLNANISQSVKVSDNNLKDLKDYVNKRVFKGSEYQL--SEINSGSVKYE---QTYDNFPILNNSKAMLNFNIE------------------DNKAASYKQSMMDDIKPTDGADKKHQVIGVRKAIEALYYNRYLKKGDEVINARLGYYSVVNETNVQLLQPNWEI--KVKHD-----GKDKTNTYYVEATNNNPKIINH--------------------------------------------
4AMQ Chain:A ((22-381))RMLIFTYKLERYIKNKILPKILVVPDRDKYQIKGSFRRRIPYITDIDIVNNVHPEYDDTNIYQRIVDLINSFTNDNQIKLIYVICGTDDRFLLTEYSDEEIEKIK--ILLN----PTELVELNNVNKKVFYINEIIWDLYKLRWTSSEVLAGKKILRGGIEVSFQDVVKNNSILLLQYFVKIEYYPIGFDIAVRYKPFYQLKLANYSKEYYFMLFPLRFYFKND--PTISKQLEYIIETKF--GLYKQLLVRIDSYRTIYESGNLDLDTAKSIIISIIKDIRKLNGIDMNIIDKIQEVSNNSAGQDKIIAWNTLLTQLYTNINKSVNKQSKKYFTRYINIIPKEDRKLCCL


General information:
TITO was launched using:
RESULT:

Template: 4AMQ.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) 26615 for 1474 contacts (18.1/contact) +
2D Compatibility (PS) -25327 + (NN) 8204 + (LL) 448
1D Compatibility (HY) -12000 + (ID) 2400
Total energy: -4460.0 ( -3.03 by residue)
QMean score : 0.160

(partial model without unconserved sides chains):
PDB file : Tito_4AMQ.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-4AMQ-query.scw
PDB file : Tito_Scwrl_4AMQ.pdb: