Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MRREERNMDKLLISFLLSLFMVYFPPSDVVLPSQFEASTDSYVPMSSYPQETQSAKTPSPGSMHPAELIKEYSPLAQSVRQL----SVKPLDEPLINRLEKALAVPVKYQSNYLRI 1LQ7 Chain:A ((1-67)) --------------------------------------GSRVKALEEKVKALEEKVKALGGGGRIEELKKKWEELKKKIEELGGGGEVKKVEEE-VKKLEEEIKKL----------

General information: TITO was launched using: RESULT: Template: 1LQ7.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 206 -15187 -73.72 -241.06 target 2D structure prediction score : 0.70 Monomeric hydrophicity matching model chain A : 0.59 3D Compatibility (PKB) : -73.72 2D Compatibility (Sec. Struct. Predict.) : 0.70 1D Compatibility (Hydrophobicity) : 0.59 QMean score : 0.504

(partial model without unconserved sides chains): PDB file : Tito_1LQ7.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1LQ7-query.scw PDB file : Tito_Scwrl_1LQ7.pdb: