Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MMKNGFAYKNGKLVNIFCGKEELYNELKAFLVKTFSINVKEVSRPSIYRRTKSKQLE- 1ED7 Chain:A ((655-698)) AWQVNTAYTAGQLVTYNG--------------KTYKCLQPHTSLAGWEPSNVPALWQL

General information: TITO was launched using: RESULT: Template: 1ED7.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 143 -5074 -35.48 -117.99 target 2D structure prediction score : 0.60 Monomeric hydrophicity matching model chain A : 0.60 3D Compatibility (PKB) : -35.48 2D Compatibility (Sec. Struct. Predict.) : 0.60 1D Compatibility (Hydrophobicity) : 0.60 QMean score : 0.317

(partial model without unconserved sides chains): PDB file : Tito_1ED7.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1ED7-query.scw PDB file : Tito_Scwrl_1ED7.pdb: