Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MTDQHLEDLIVHIVTPLVDHPDDIRVIREETDQKIALRLSVHKSDTGKVIGKQGRTAKAIRTAVFAAGVQS-SKKVQFEIFD 2PT7 Chain:G ((116-192)) --LHEIKQELKDLFSHLPYKINKVEVSLY---EPGVLLIDIDGEDSALLIGEKGYRYKALSYLLFNWIHPTYGYSIRLEIST

General information: TITO was launched using: RESULT: Template: 2PT7.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain G - contact count / total energy / energy per contact / energy per residue : 256 -43909 -171.52 -577.74 target 2D structure prediction score : 0.70 Monomeric hydrophicity matching model chain G : 0.70 3D Compatibility (PKB) : -171.52 2D Compatibility (Sec. Struct. Predict.) : 0.70 1D Compatibility (Hydrophobicity) : 0.70 QMean score : 0.289

(partial model without unconserved sides chains): PDB file : Tito_2PT7.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2PT7-query.scw PDB file : Tito_Scwrl_2PT7.pdb: