Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MFKDKNKIIKSVEKINKLEEGLSLFEEGDEEYLSVLVKIQGLYDEISDTALECFKEMTTKIRKTGQKRIIKGIDQLPHTIKENI-ADQVNDFKGGAI 1CTF Chain:A ((19-63)) -------------------------------------------------KVAVIKAVRGA-TGLGLKEAKDLVESAPAALKEGVSKDDAEALKKA--

General information: TITO was launched using: RESULT: Template: 1CTF.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 88 -7279 -82.72 -165.43 target 2D structure prediction score : 0.68 Monomeric hydrophicity matching model chain A : 0.61 3D Compatibility (PKB) : -82.72 2D Compatibility (Sec. Struct. Predict.) : 0.68 1D Compatibility (Hydrophobicity) : 0.61 QMean score : 0.663

(partial model without unconserved sides chains): PDB file : Tito_1CTF.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1CTF-query.scw PDB file : Tito_Scwrl_1CTF.pdb: