Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MEMDITQYLSTQGPFAVLFCWLLFYVMKTSKERESKLYNQIDSQNEVLGKFSEKYDVVIEKLDKIEQNFK 1TXP Chain:B ((180-207)) ----------------------------------------IQAIKKELTQIKQKVDSLLENLEKIEKE--

General information: TITO was launched using: RESULT: Template: 1TXP.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 4 229 57.25 8.18 target 2D structure prediction score : 0.79 Monomeric hydrophicity matching model chain B : 0.61 3D Compatibility (PKB) : 57.25 2D Compatibility (Sec. Struct. Predict.) : 0.79 1D Compatibility (Hydrophobicity) : 0.61 QMean score : 0.556

(partial model without unconserved sides chains): PDB file : Tito_1TXP.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1TXP-query.scw PDB file : Tito_Scwrl_1TXP.pdb: