Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceKRLVVQRVTEASVTVDEEVVGQ------IGQGLMVLVGITHDDTEDDAAYLADKVVNLRIFDDSEGKMNLSLVDIGGEILSVSQFTLYGDTKKGRRPNYMNAAKPDKALGLYEKWNDLLREK--GIKVETGTFGAMMDVQLTNSGPVTLIMDSK
4NBI Chain:B ((2-157))-RVVIQRVKGAILSVRK-----LEIISEIKNGLICFLGIHKNDTWEDALYIIRKCLNLRLWNNDNKTWDKNVKDLNYELLIVSQFTLFGNTKKGNKPDFHLAKEPNEALIFYNKIIDEFKKQYNDDKIKIGKFGNYMNIDVTNDGPVTIYIDT-


General information:
TITO was launched using:
RESULT:

Template: 4NBI.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 624 17766 28.47 127.81
target 2D structure prediction score : 0.65
Monomeric hydrophicity matching model chain B : 0.83

3D Compatibility (PKB) : 28.47
2D Compatibility (Sec. Struct. Predict.) : 0.65
1D Compatibility (Hydrophobicity) : 0.83
QMean score : 0.564

(partial model without unconserved sides chains):
PDB file : Tito_4NBI.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-4NBI-query.scw
PDB file : Tito_Scwrl_4NBI.pdb: