Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKELQEHELDHIEDDVYLLYLYTPFCGTCQLASKMLTVVKEMLPD-VAFYQNNVNYSPTFAKAYQIESVPCFLLFKGGKMVER--GYAFHSVSYLYELIKQKSSSASHL 1NW2 Chain:B ((17-90)) -------------DKPVLVDFWAAWCGPCRMMAPVLEEFAEAHADKVTVAKLNVDENPETTSQFGIMSIPTLILFKGGEPVKQLIGY----------------------

General information: TITO was launched using: RESULT: Template: 1NW2.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 238 -30586 -128.51 -430.79 target 2D structure prediction score : 0.63 Monomeric hydrophicity matching model chain B : 0.72 3D Compatibility (PKB) : -128.51 2D Compatibility (Sec. Struct. Predict.) : 0.63 1D Compatibility (Hydrophobicity) : 0.72 QMean score : 0.696

(partial model without unconserved sides chains): PDB file : Tito_1NW2.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1NW2-query.scw PDB file : Tito_Scwrl_1NW2.pdb: