Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MHDYIKERTIKIGKYIV-ETKKTVRVIAKEFGVSKSTVHKDLTERLPEINPDLANEVKEILDYHKSIRHLRGGEATKLKYKKDEILEGEPVQQS 3BDN Chain:A ((16-73)) ------RRLKAIYEKKKNELGLSQESVADKMGMGQSGVGALFNGI-NALNAYNAALLAKILKV-------------------------------

General information: TITO was launched using: RESULT: Template: 3BDN.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 136 4209 30.95 76.53 target 2D structure prediction score : 0.44 Monomeric hydrophicity matching model chain A : 0.65 3D Compatibility (PKB) : 30.95 2D Compatibility (Sec. Struct. Predict.) : 0.44 1D Compatibility (Hydrophobicity) : 0.65 QMean score : 0.548

(partial model without unconserved sides chains): PDB file : Tito_3BDN.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3BDN-query.scw PDB file : Tito_Scwrl_3BDN.pdb: