Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MYVGRDMSELNMVSKKDWKNSELAYFHHAFQQIMPYLNEEGQSKYRELTQEIEARGGMKRNEADYSHGTRVSYD 3I71 Chain:A ((20-59)) ----------------------------TAGEVAAHFGWP-LEKARNALEQLFSAGTLRKRSSRYRLKP-----

General information: TITO was launched using: RESULT: Template: 3I71.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 63 -4644 -73.71 -116.09 target 2D structure prediction score : 0.78 Monomeric hydrophicity matching model chain A : 0.62 3D Compatibility (PKB) : -73.71 2D Compatibility (Sec. Struct. Predict.) : 0.78 1D Compatibility (Hydrophobicity) : 0.62 QMean score : 0.541

(partial model without unconserved sides chains): PDB file : Tito_3I71.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3I71-query.scw PDB file : Tito_Scwrl_3I71.pdb: