Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MERFIKRLSASCESTIHHKVYQIMNEAKTEFEKVLKKLK 2IBF Chain:D ((5-23)) --------------------YEKAKEVSSALSKVLSKID

General information: TITO was launched using: RESULT: Template: 2IBF.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain D - contact count / total energy / energy per contact / energy per residue : 4 -447 -111.75 -23.53 target 2D structure prediction score : 0.84 Monomeric hydrophicity matching model chain D : 0.67 3D Compatibility (PKB) : -111.75 2D Compatibility (Sec. Struct. Predict.) : 0.84 1D Compatibility (Hydrophobicity) : 0.67 QMean score : 0.642

(partial model without unconserved sides chains): PDB file : Tito_2IBF.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2IBF-query.scw PDB file : Tito_Scwrl_2IBF.pdb: