Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence-------------VTCSPTQLSSCVSAITSSSPP-----SKLCCSKIKEQKPCLCQYLRNPNLK-----RFINTPNARKVASTCGTPFPRC------------------------------------------------------
1KNG Chain:A ((50-193))RPAPQTALPPLEGLQADNVQVPGLDPAAFKG-KVSLVNVWASWCVPCHDEAPLLTELGKDKRFQLVGINYKDAADNARRFLGRYGNPFGRVGVDANGRASIEWGVYGVPETFVVGREGTIVYKLVGPITPDNLRSVLLPQMEKAL


General information:
TITO was launched using:
RESULT:

Template: 1KNG.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -10324 for 357 contacts (-28.9/contact) +
2D Compatibility (PS) -6912 + (NN) 256 + (LL) -28
1D Compatibility (HY) -2400 + (ID) 600
Total energy: -20008.0 ( -56.04 by residue)
QMean score : 0.428

(partial model without unconserved sides chains):
PDB file : Tito_1KNG.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1KNG-query.scw
PDB file : Tito_Scwrl_1KNG.pdb: