Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMVKTWEEFLKQEAKQPYFIELMEAVKDARAKGNVYPSEEDMFSCFRLCPYNQVKVVILGQDPYHGPGQAHGLSFSVQKDVRIPPSLRNIYKELKTDL-DIEPADHGYLAKWAEQGVLLMNTSWSVEEGKAGSHKKLGWATFTDHVLEELNNYDKPLVFILWGNHAIKAASGITNPQHLIIKGVHPSPLAASRGFFGSKPFSKTNAFLEEHERKPIDWDLNEQ
1EMJ Chain:A ((6-220))--ESWKKHLSGEFGKPYFIKLMGFVAEERKHYTVYPPPHQVFTWTQMCDIKDVKVVILGQDPYHGPNQAHGLCFSVQRPVPPPPSLENIYKELSTDIEDFVHPGHGDLSGWAKQGVLLLNAVLTVRAHQANSHKERGWEQFTDAVVSWLNQNSNGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSPLSVYRGFFGCRHFSKTNELLQKSGKKPIDW-----


General information:
TITO was launched using:
RESULT:

Template: 1EMJ.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -107921 for 1757 contacts (-61.4/contact) +
2D Compatibility (PS) -22960 + (NN) -10097 + (LL) 644
1D Compatibility (HY) -21200 + (ID) 5450
Total energy: -166984.0 ( -95.04 by residue)
QMean score : 0.722

(partial model without unconserved sides chains):
PDB file : Tito_1EMJ.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1EMJ-query.scw
PDB file : Tito_Scwrl_1EMJ.pdb: