Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMIKLGNDWDELLKNEFNQPYYLTLRQFLKKEYQTKKVFPDMYDIFNALKHTAYKDVKVVILGQDPYHGPGQAHGLSFSVQQGVQIPPSLQNIYLELHNDLNCEI-PNNGYLIPWADQGVLLLNTVLTVRAGQANSHRGQGWEILTNHIIEIINQKEEPVVFLLWGSNAKEKLQLLTNPKHTAFTSVHPSPLSASRGFMGCKHFSKTNQFLEQNGVKPIDWQIPSI
1Q3F Chain:A ((4-221))---FGESWKKHLSGEFGKPYFIKLMGFVAEERKHYTVYPPPHQVFTWTQMCDIKDVKVVILGQDPYHGPNQAHGLCFSVQRPVPPPPSLENIYKELSTDIEDFVHPGHGDLSGWAKQGVLLLNAVLTVRAHQANSHKERGWEQFTDAVVSWLNQNSNGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSPLSVYRGFFGCRHFSKTNELLQKSGKKPIDWK----


General information:
TITO was launched using:
RESULT:

Template: 1Q3F.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -96905 for 1800 contacts (-53.8/contact) +
2D Compatibility (PS) -23159 + (NN) -9031 + (LL) 716
1D Compatibility (HY) -19200 + (ID) 5600
Total energy: -153179.0 ( -85.10 by residue)
QMean score : 0.574

(partial model without unconserved sides chains):
PDB file : Tito_1Q3F.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1Q3F-query.scw
PDB file : Tito_Scwrl_1Q3F.pdb: