Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MNRDQEKIQIENEMNAMHGTIKEDILKDFEEFKGYLKKQVNRGKKLGLDDGKLVKSAAILGDYLAKHEEPQNGEEMLLQELWSVADEDE---KEHLAQLLVKLVDKQ 2QW6 Chain:A ((241-328)) ----------YDVISAFQKSIRGS---DVDAALHYLARLVEAG-----DLASICRRLMVIGYE----DINPAAAARTVNAVLAAEKLGLPEARIPLADVVVDLCLSP

General information: TITO was launched using: RESULT: Template: 2QW6.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 307 -31145 -101.45 -379.82 target 2D structure prediction score : 0.78 Monomeric hydrophicity matching model chain A : 0.65 3D Compatibility (PKB) : -101.45 2D Compatibility (Sec. Struct. Predict.) : 0.78 1D Compatibility (Hydrophobicity) : 0.65 QMean score : 0.498

(partial model without unconserved sides chains): PDB file : Tito_2QW6.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2QW6-query.scw PDB file : Tito_Scwrl_2QW6.pdb: