Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MLFFPWWVYLCIVGIIFSAYKLVAAAKEEEKVDQAFIEKEGQIYMERMEKERERRSSQQHEEENQNHSIA 1TU3 Chain:F ((21-66)) ------------------AQRLQTELDVSEQVQRDFVKLS-QTLQVQLERIRQADSLERIRAILN-----

General information: TITO was launched using: RESULT: Template: 1TU3.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain F - contact count / total energy / energy per contact / energy per residue : 26 -392 -15.06 -8.51 target 2D structure prediction score : 0.72 Monomeric hydrophicity matching model chain F : 0.53 3D Compatibility (PKB) : -15.06 2D Compatibility (Sec. Struct. Predict.) : 0.72 1D Compatibility (Hydrophobicity) : 0.53 QMean score : 0.453

(partial model without unconserved sides chains): PDB file : Tito_1TU3.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1TU3-query.scw PDB file : Tito_Scwrl_1TU3.pdb: