Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKIAKVGNVIEFKNGLTGVVEKVNENSVIVDVTIMDNYRDLELDSLTVVNHKNYKIIRDSY 3UDC Chain:A ((127-147)) -DQFSVGDYVTIN-GISGTVEEI--------------------------------------

General information: TITO was launched using: RESULT: Template: 3UDC.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 36 -7554 -209.83 -359.71 target 2D structure prediction score : 0.38 Monomeric hydrophicity matching model chain A : 0.63 3D Compatibility (PKB) : -209.83 2D Compatibility (Sec. Struct. Predict.) : 0.38 1D Compatibility (Hydrophobicity) : 0.63 QMean score : 0.856

(partial model without unconserved sides chains): PDB file : Tito_3UDC.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3UDC-query.scw PDB file : Tito_Scwrl_3UDC.pdb: