Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMKERGLLIVLSGPSGVGKGTVRQAIFSQE---DTKFEYSISVTTRSPREGEVNGVDYFFKTRDEFEQMIADNKLLEWAEYVGNYYGTPVDYVEQTLQDGKDVFLEIEVQGALQVRNAFPEGLFIFLAPPSLSELKNRIVTRGTETDALIENRMKAAKAEIEMMDAYDYVVENDNVETACDKIKAIVLAEHLKRERVAPRYKKMLEVE
2AN9 Chain:B ((3-201))---QGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQV--SVSHTTRQPRPGEVHGEHYFFVNHDEFKEMISRDAFLEHAEVFGNYYGTSREAIEQVLATGVDVFLDIDWQGAQQIRQKMPHARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAQAVAEMSHYAEYDYLIVNDDFDTALTDLKTIIRAERLRMSRQKQRHDALI---


General information:
TITO was launched using:
RESULT:

Template: 2AN9.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 819 -73573 -89.83 -375.37
target 2D structure prediction score : 0.66
Monomeric hydrophicity matching model chain B : 0.81

3D Compatibility (PKB) : -89.83
2D Compatibility (Sec. Struct. Predict.) : 0.66
1D Compatibility (Hydrophobicity) : 0.81
QMean score : 0.495

(partial model without unconserved sides chains):
PDB file : Tito_2AN9.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-2AN9-query.scw
PDB file : Tito_Scwrl_2AN9.pdb: