Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence --------------MFKKGQKVIVDFTDEIGAVAKVDY-RYNQIEVKYPDGTYQVVGFHKVRKVED--- 2XK0 Chain:A ((7-75)) GAMAPPVAAPSPAVTYALQEDVFIKCNDGRFYLGTIIDQTSDQYLIRFDDQSEQWCEPDKLRKLGGGSS

General information: TITO was launched using: RESULT: Template: 2XK0.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 117 9238 78.96 181.14 target 2D structure prediction score : 0.61 Monomeric hydrophicity matching model chain A : 0.64 3D Compatibility (PKB) : 78.96 2D Compatibility (Sec. Struct. Predict.) : 0.61 1D Compatibility (Hydrophobicity) : 0.64 QMean score : 0.538

(partial model without unconserved sides chains): PDB file : Tito_2XK0.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2XK0-query.scw PDB file : Tito_Scwrl_2XK0.pdb: