Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKCIQIEMSFTDEYGQVTRLNKTYKPSIIEEHKGEIPRLLLDDFKRFLSSLGFNEKQVSRIVTED 2LE2 Chain:A ((1-56)) ----MVQNDFVDSYDVTMLLQDDDGKQYYEYHKG----LSLSDFEVLYGNTADEIIKLRLDKVL-

General information: TITO was launched using: RESULT: Template: 2LE2.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 186 -2240 -12.04 -39.99 target 2D structure prediction score : 0.39 Monomeric hydrophicity matching model chain A : 0.60 3D Compatibility (PKB) : -12.04 2D Compatibility (Sec. Struct. Predict.) : 0.39 1D Compatibility (Hydrophobicity) : 0.60 QMean score : 0.253

(partial model without unconserved sides chains): PDB file : Tito_2LE2.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2LE2-query.scw PDB file : Tito_Scwrl_2LE2.pdb: