Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MTKLKMLSMLTVMIASLFIFSSQALAVQYFTVSTSSGAPVNMRSGPGTNYPIMLSIPSGSRVPYYCYAYGTTVTGKYGTSNIWDQIQWKDSRGVVNIGYVSDTYVYTGSDGPVGYKCN 4KRT Chain:A ((229-286)) ------------------------------------STKLNIRAKGTTNSKIIGSIPAGETFKIKWVD---------EDYLGWYYVEYNGVVGYVNADYVEKL---------------

General information: TITO was launched using: RESULT: Template: 4KRT.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 211 -23708 -112.36 -408.75 target 2D structure prediction score : 0.40 Monomeric hydrophicity matching model chain A : 0.54 3D Compatibility (PKB) : -112.36 2D Compatibility (Sec. Struct. Predict.) : 0.40 1D Compatibility (Hydrophobicity) : 0.54 QMean score : 0.295

(partial model without unconserved sides chains): PDB file : Tito_4KRT.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4KRT-query.scw PDB file : Tito_Scwrl_4KRT.pdb: