Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MNFQLDLIKDKVEFFEAASLQELEKKINTQIENNKAIMLRVKSVSHQTLV-AEGRILYSAVVHFSAEA 3RMR Chain:A ((192-250)) ---------HDVDFFAPTAFTFLVKCVESEDDANNAIFE---------YFGSNPSRYFSAVLHA----

General information: TITO was launched using: RESULT: Template: 3RMR.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 105 -17488 -166.55 -388.61 target 2D structure prediction score : 0.22 Monomeric hydrophicity matching model chain A : 0.73 3D Compatibility (PKB) : -166.55 2D Compatibility (Sec. Struct. Predict.) : 0.22 1D Compatibility (Hydrophobicity) : 0.73 QMean score : 0.571

(partial model without unconserved sides chains): PDB file : Tito_3RMR.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3RMR-query.scw PDB file : Tito_Scwrl_3RMR.pdb: