Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKELQEHELDHIEDDVYLLYLYTPFCGTCQLASKMLTVVKEMLPD-VAFYQNNVNYSPTFAKAYQIESVPCFLLFKGGKMVER--GYAFHSVSYLYELIKQKSSSASHL 1NW2 Chain:A ((17-90)) -------------DKPVLVDFWAAWCGPCRMMAPVLEEFAEAHADKVTVAKLNVDENPETTSQFGIMSIPTLILFKGGEPVKQLIGY----------------------

General information: TITO was launched using: RESULT: Template: 1NW2.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 229 -25058 -109.42 -352.93 target 2D structure prediction score : 0.68 Monomeric hydrophicity matching model chain A : 0.72 3D Compatibility (PKB) : -109.42 2D Compatibility (Sec. Struct. Predict.) : 0.68 1D Compatibility (Hydrophobicity) : 0.72 QMean score : 0.679

(partial model without unconserved sides chains): PDB file : Tito_1NW2.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1NW2-query.scw PDB file : Tito_Scwrl_1NW2.pdb: