Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence-MTCFLVRDLLPLYLEGDCKRETEHVIEEHLKMCSSCRDMYDTMAEPFELESEQAVEEAYLPEEELRFKQRYYGLLIMKAACWFGAAVAMMLIIKLLI---------------------------------------------------------------------------------------
2Q1Z Chain:B ((2-194))TIRHHVSDALLTAYAAGTLSEAFSLVVATHLSLCDECRARAGALDAVGGSLMEETAPVALSEGSLASVMAQLDRQIADPRAPAPLADYVGRRLEDVRWRTLGGGVRQAILPTGGEAIARLLWIPGGQAVPDHGHRGLELTLVLQGAFRDETDRFGAGDIEIADQELEHTPVAERGLDCICLAATD


General information:
TITO was launched using:
RESULT:

Template: 2Q1Z.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 198 -39750 -200.76 -409.79
target 2D structure prediction score : 0.52
Monomeric hydrophicity matching model chain B : 0.57

3D Compatibility (PKB) : -200.76
2D Compatibility (Sec. Struct. Predict.) : 0.52
1D Compatibility (Hydrophobicity) : 0.57
QMean score : 0.383

(partial model without unconserved sides chains):
PDB file : Tito_2Q1Z.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-2Q1Z-query.scw
PDB file : Tito_Scwrl_2Q1Z.pdb: