Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence -----------------------MERFIKRLSAS-CESTIHHKVYQIMNEAKTEF-EKVLKKLK--------------------------------------------------------------------------------------- 1F1E Chain:A ((4-154)) ELPKAAIERIFRQGIGERRLSQDAKDTIYDFVPTMAEYVANAAKSVLDASGKKTLMEEHLKALADVLMVEGVEDYDGELFGRATVRRILKRAGIERASSDAVDLYNKLICRATEELGEKAAEYADEDGRKTVQGEDVEKAITYSMPKGGEL

General information: TITO was launched using: RESULT: Template: 1F1E.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 63 9428 149.64 241.73 target 2D structure prediction score : 0.69 Monomeric hydrophicity matching model chain A : 0.59 3D Compatibility (PKB) : 149.64 2D Compatibility (Sec. Struct. Predict.) : 0.69 1D Compatibility (Hydrophobicity) : 0.59 QMean score : 0.514

(partial model without unconserved sides chains): PDB file : Tito_1F1E.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1F1E-query.scw PDB file : Tito_Scwrl_1F1E.pdb: