Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence---------------------------------------------------------------------------------------QDCDAGKLI-VCAAAIIGGAEPSASCCSNLKAQQGCLCKYASN-PAYSGYINSPTARKTLTSCGIPIPTCPQ
1ELK Chain:A ((1-153))SDFLLGNPFSSPVGQRIEKATDGSLQSEDWALNMEICDIINETEEGPKDALRAVKKRIVGNKNFHEVMLALTVLETCVKNCGHRFHVLVASQDFVESVLVRTILPKNNPPTIVHDKVLNLIQSWADAFRSSPDLTGV---VTIYEDLRRKGLEFPM---


General information:
TITO was launched using:
RESULT:

Template: 1ELK.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -22742 for 387 contacts (-58.8/contact) +
2D Compatibility (PS) -6572 + (NN) -756 + (LL) 132
1D Compatibility (HY) -2400 + (ID) 450
Total energy: -32788.0 ( -84.72 by residue)
QMean score : 0.354

(partial model without unconserved sides chains):
PDB file : Tito_1ELK.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1ELK-query.scw
PDB file : Tito_Scwrl_1ELK.pdb: