Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence -IDLCGMSQDELNECKPAVSKENPTSPSQPCCTALQHA--------DFACLCGYKNSPWLGSFGVDPELASALPKQCGLANA------PTC---- 1FK5 Chain:A ((1-93)) AIS-CGQVASAIAPCISYARGQGSG-PSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRVN

General information: TITO was launched using: RESULT: Template: 1FK5.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output 3D Compatibility (PKB) -16330 for 492 contacts (-33.2/contact) + 2D Compatibility (PS) -7710 + (NN) -3843 + (LL) 148 1D Compatibility (HY) -2000 + (ID) 850 Total energy: -30585.0 ( -62.16 by residue) QMean score : 0.339

(partial model without unconserved sides chains): PDB file : Tito_1FK5.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1FK5-query.scw PDB file : Tito_Scwrl_1FK5.pdb: