Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence-MSILLELQFYLSLPHIFSYQQMHKNEEISEAKTSRNAEEVKEIVKTQLEG-------------LKQLKKQLKQKLGV------------------------------------------------------------------------------------------------------
3JYG Chain:A ((2-181))SLIYQIAKEFDFCYGHRVWSQELNPDFSLDPCLSCRHLHGHQGKVIVHLESRELQRGMVTDFAHLNWFKRFIDEVLDHRFIIDIDDPLFPTLLPHFADKSALVWMEEGYARVDFERIKGESSPILELYESFVVVRFVPTSESIASWLLELLRSRIQPLGVKVSSVEFLETPKSRARVYNE


General information:
TITO was launched using:
RESULT:

Template: 3JYG.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -505 for 308 contacts (-1.6/contact) +
2D Compatibility (PS) -6614 + (NN) 439 + (LL) 0
1D Compatibility (HY) -2800 + (ID) 500
Total energy: -9980.0 ( -32.40 by residue)
QMean score : 0.171

(partial model without unconserved sides chains):
PDB file : Tito_3JYG.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-3JYG-query.scw
PDB file : Tito_Scwrl_3JYG.pdb: