Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMIRIGQGYDVHKLAYDRDLIIGGVKIPYEKGLLGHSDADVLLHAITDAIIGAIGAGDIGHFFPDTDMVFKDADSAELLAEIWQKVEADGFRLGNLDATIIAEKPKMAPYVEQMKLRIAELLHADSAQVNVKATTTEKLGFTGREEGIASLAVVLLEK
1H48 Chain:D ((3-158))-MRIGHGFDVHAFGGEGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLGCHMDDVNVKATTTEKLGFTGRGEGIACEAVALLIK


General information:
TITO was launched using:
RESULT:

Template: 1H48.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -107890 for 1330 contacts (-81.1/contact) +
2D Compatibility (PS) -17328 + (NN) -10451 + (LL) 208
1D Compatibility (HY) -14000 + (ID) 4850
Total energy: -154311.0 ( -116.02 by residue)
QMean score : 0.599

(partial model without unconserved sides chains):
PDB file : Tito_1H48.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1H48-query.scw
PDB file : Tito_Scwrl_1H48.pdb: