Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMLYTMKDLLAVGKEHQFAVPAFNICSFDMLKAIMEEVEANNAPVILEIHPDEIEYLG-DNFVATVREYAYR-SKVPVVIHMDHGGTIKDVMRAIRNGYTSVMIDASRASYEENVALTTQVVELAHKVGVSVEAELGTI-GNNGSAEGGADTIIYTDPDQAEDFVSRTGIDTLAVAIGTAHGLYPKDKKPELNMPLLKELNKRLDIPFVLHGGSGNPD---------------------KEVSESVQYGVRKVNLSSDLKSVFFEEVRRVLVDNPAMYEPNQVYPSANEKVKDVVRHKLDILNTTGQADKY
3N9R Chain:K ((1-306))MLVKGNEILLKAHKEGYGVGAFNFVNFEMLNAIFEAGNEENSPLFIQASEGAIKYMGIDMAVGMVKIMCERYPHIPVALHLDHGTTFESCEKAVKAGFTSVMIDASHHAFEENLELTSKVVKMAHNAGVSVEAELGRLMGI----------AVLVNPKEAEQFVKESQVDYLAPAIGTSHGAFKFKGEPKLDFERLQEVKRLTNIPLVLHGASAIPDNVRKSYLDAGGDLKGSKGVPFEFLQESVKGGINKVNTDTDLRIAFIAEVRKVANEDKSQFDLRKFFSPAQLALKNVVKERMKLLGSANK----


General information:
TITO was launched using:
RESULT:

Template: 3N9R.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -151138 for 2379 contacts (-63.5/contact) +
2D Compatibility (PS) -30136 + (NN) -15773 + (LL) -32
1D Compatibility (HY) -23600 + (ID) 5200
Total energy: -225879.0 ( -94.95 by residue)
QMean score : 0.697

(partial model without unconserved sides chains):
PDB file : Tito_3N9R.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-3N9R-query.scw
PDB file : Tito_Scwrl_3N9R.pdb: