Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMNKDKLRYAILKEIFEGNTPLSENDI----GVTEDQFDDAVNFLKREGYIIGVHYSDDRPHLYKLGPELTEKGENYLKENGTWSKAYKTIKEIKDWIK---------------------------------------------------------------------------------------------------------------------------------------------------------
1MKM Chain:A ((4-249))MNTLKKAFEILDFIVKNPGDVSVSEIAEKFNMSVSNAYKYMVVLEEKGFVLR-----KKDKRYVPGYKLIEYGSFVLRRFNIRDIAHDHLVDIMKRTGETVHLILKDGFEGVYIDKVEGEQSIPMVSRLGMKVDLYSTASGKSILAFVPEKELKEYLKIVELKPKTPNTITNPRVLKRELEKIRKRGYAVDNEENEIGIMCVGVPIFDHNGYPVAGVSISGVARKFTEEKIEEYSDVLKEKAEEISRKLGY


General information:
TITO was launched using:
RESULT:

Template: 1MKM.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 205 -31986 -156.03 -359.39
target 2D structure prediction score : 0.79
Monomeric hydrophicity matching model chain A : 0.57

3D Compatibility (PKB) : -156.03
2D Compatibility (Sec. Struct. Predict.) : 0.79
1D Compatibility (Hydrophobicity) : 0.57
QMean score : 0.610

(partial model without unconserved sides chains):
PDB file : Tito_1MKM.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1MKM-query.scw
PDB file : Tito_Scwrl_1MKM.pdb: