Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MTSEMQLQAQIDVIEKENKELRRRNEELGQTVECQNKQIVTQNWRLLFFASSWIVYGIVSAIKYLWG 5B16 Chain:B ((1-25)) -------MANLHILSKLQEEMKRLAEEREETR-----------------------------------

General information: TITO was launched using: RESULT: Template: 5B16.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 4 -172 -42.88 -6.86 target 2D structure prediction score : 0.48 Monomeric hydrophicity matching model chain B : 0.52 3D Compatibility (PKB) : -42.88 2D Compatibility (Sec. Struct. Predict.) : 0.48 1D Compatibility (Hydrophobicity) : 0.52 QMean score : 0.703

(partial model without unconserved sides chains): PDB file : Tito_5B16.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5B16-query.scw PDB file : Tito_Scwrl_5B16.pdb: