Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence----------------------MNKWKRLFFILLAINFIL--AAGFVALVLLPGEQAQVKDASESEYGFQVTSTKESLAAFVNSYLNDKASNKLDYKVEIDDDVHVAGKIKAFSTSIDAFIAFEPTVKKNGDVELNVTKFSLGKLSIPISFVLNYMDSFYELPSFVHVHPGDKSIEVRL---SEMPLTNGMYVKA----------------------DKINLEKDEIEF---SYYHPKQ
1J1T Chain:A ((6-233))STIPSSITSGSIFDLEGDNPNPLVDDSTLVFVPLEAQHITPNGNGWRHEYKVKESLRVAMTQTYEVFEATVKVEMSDGGKTIISQHHASDTGTISKVYVSDTDESGFNDSVANNGIFDVYVRLR-------NTSGNEEKFALGTMTSGETFNLRVVNNY----GDVEVTAFGNSFGIPVEDDSQSYFKFGNYLQSQDPYTLDKCGEAGNSNSFKNCFEDLGITESKVTMTNVTYTRETN


General information:
TITO was launched using:
RESULT:

Template: 1J1T.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 865 44532 51.48 253.02
target 2D structure prediction score : 0.41
Monomeric hydrophicity matching model chain A : 0.64

3D Compatibility (PKB) : 51.48
2D Compatibility (Sec. Struct. Predict.) : 0.41
1D Compatibility (Hydrophobicity) : 0.64
QMean score : 0.207

(partial model without unconserved sides chains):
PDB file : Tito_1J1T.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1J1T-query.scw
PDB file : Tito_Scwrl_1J1T.pdb: