Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMF---VMVLRIILLALFAYCIYAVVKYVANPKRRLKLAQ------SKEHFYIIDEQNNTRKNFQLTYKGVLFEGEKHIPSKDHPLFIHTIFVWTESPEKLKHFSAKDFENIEEK-------VLERYPNCKI--DWDQPIKLAKKAEER--------------------------------------------------
5A9H Chain:A ((1-194))MAASQEIFLQVLNLADGD----VKVTVLGSRNNSLLVESVSSFQNTTHYSKLHLEAKSQDLHFHLKYNSLSVHNDHSVEEKN----CYQLLIHQDGE-SISSMLVKDTGIKPANGMAAIRFINTLHKDLNISLDTDAPLSVGKDYGVSAYRTVLRGKYPAVHCETEDKVFSLDLGQLDFGTTYLFVITNLQAWKAEDI


General information:
TITO was launched using:
RESULT:

Template: 5A9H.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 505 14979 29.66 123.79
target 2D structure prediction score : 0.34
Monomeric hydrophicity matching model chain A : 0.59

3D Compatibility (PKB) : 29.66
2D Compatibility (Sec. Struct. Predict.) : 0.34
1D Compatibility (Hydrophobicity) : 0.59
QMean score : 0.322

(partial model without unconserved sides chains):
PDB file : Tito_5A9H.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-5A9H-query.scw
PDB file : Tito_Scwrl_5A9H.pdb: