Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence -------------------------------------MRPLQISAETAQKLAESLNLPLEQIMHMPQHILLAKMAELQKEDKS------------ 4OX0 Chain:A ((9-101)) PSREALAVELSSQQEYLKLKERYDALQRTQRNLLGEDLGPL--STKELESLERQLDSSLKQIRALRTQFMLDQLNDLQSKERMLTETNKTLRLRL

General information: TITO was launched using: RESULT: Template: 4OX0.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 18 -1365 -75.81 -31.01 target 2D structure prediction score : 0.84 Monomeric hydrophicity matching model chain A : 0.69 3D Compatibility (PKB) : -75.81 2D Compatibility (Sec. Struct. Predict.) : 0.84 1D Compatibility (Hydrophobicity) : 0.69 QMean score : 0.370

(partial model without unconserved sides chains): PDB file : Tito_4OX0.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4OX0-query.scw PDB file : Tito_Scwrl_4OX0.pdb: