Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence---------------------------MFMKKLMLAVGLFAVA---GSAFAAKPCEELKAEIDAKIKANGVPAYTLEIVDKGSVTDKKVVGTCDGGTKEIVYQRG-------------------------------------------------------
1QMY Chain:A ((1-156))MELTLYNGEKKTFYSRPNNHDNAWLNAILQLFRYVEEPFFDWVYSSPENLTLEAIKQLEDLTGLELHEGGPPALVIWNIKHLLHTG---IGTASR-PSEVCVVDGTDMSLADFHAGIFLKGQEHAVFACVTSNGWYAIDDEDFYPWTPDPSDVLVFVPYD


General information:
TITO was launched using:
RESULT:

Template: 1QMY.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -22190 for 428 contacts (-51.8/contact) +
2D Compatibility (PS) -7550 + (NN) -2012 + (LL) 148
1D Compatibility (HY) -4000 + (ID) 500
Total energy: -36104.0 ( -84.36 by residue)
QMean score : 0.299

(partial model without unconserved sides chains):
PDB file : Tito_1QMY.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1QMY-query.scw
PDB file : Tito_Scwrl_1QMY.pdb: