Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence---------------QCNAGQLAICAGAIIGGSTPSASCCSNLRAQRGCFCQYAR-NPAY-----ASYINSANARKTLTSCGIAIPRC--------------------------------------------------
1LU4 Chain:A ((1001-1134))ADERLQFTATTLSGAPFDGASLQGKPAVLWFWTP----WCPFCNAEAPSLSQVAAANPAVTFVGIATRADVGAMQSFVSKYNLNFTNLNDADGVIWARYNVPWQPAFVFYRADGTSTFVNNPTAAMSQDELSGRVAAL


General information:
TITO was launched using:
RESULT:

Template: 1LU4.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -25730 for 352 contacts (-73.1/contact) +
2D Compatibility (PS) -6378 + (NN) -392 + (LL) -52
1D Compatibility (HY) -3600 + (ID) 450
Total energy: -36602.0 ( -103.98 by residue)
QMean score : 0.265

(partial model without unconserved sides chains):
PDB file : Tito_1LU4.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1LU4-query.scw
PDB file : Tito_Scwrl_1LU4.pdb: