Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence---------------------------------------------------------------------------GIVKVSWGEK-KVACTVTEL-QPCLPSVIDGSQPSTQCCEKLKEQNSCFCDYLQN-PQFSQYITAAKQILAACKIPYPNC
1ELK Chain:A ((1-153))SDFLLGNPFSSPVGQRIEKATDGSLQSEDWALNMEICDIINETEEGPKDALRAVKKRIVGNKNFHEVMLALTVLETCVKNCGHRFHVLVASQDFVESVLVRTILPKNNPPTIVHDKVLNLIQSWADAFRSSPDL-TGVVTIYEDLRRKGLEFPM-


General information:
TITO was launched using:
RESULT:

Template: 1ELK.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -23097 for 443 contacts (-52.1/contact) +
2D Compatibility (PS) -8034 + (NN) -5563 + (LL) 28
1D Compatibility (HY) -2400 + (ID) 450
Total energy: -39516.0 ( -89.20 by residue)
QMean score : 0.340

(partial model without unconserved sides chains):
PDB file : Tito_1ELK.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1ELK-query.scw
PDB file : Tito_Scwrl_1ELK.pdb: